PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.3982s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 383aa    MW: 43763.9 Da    PI: 5.5291
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.3982s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.53.7e-55461751129
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                             +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL++     ++e++ewyfFs++dkky+tg+r+nrat +g+Wk
  SapurV1A.3982s0010.1.p  46 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLQErcrIGYEEQNEWYFFSHKDKKYPTGTRTNRATMAGFWK 131
                             69****************************.9***************953432233667**************************** PP

                     NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                             atg+dk+v++ k++l+g++ktLvfykgrap+g+k+dW+mheyrle
  SapurV1A.3982s0010.1.p 132 ATGRDKSVYD-KTKLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 175
                             **********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.68E-6137195IPR003441NAC domain
PROSITE profilePS5100559.40546195IPR003441NAC domain
PfamPF023658.4E-2947174IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MKNLDKQTKW SDPVSALMRH TLCSRKTGAH ETASTVVMME SMESCVPPGF RFHPTDEELV  60
GYYLRKKVAS QKIDLDVIRD IDLYRIEPWD LQERCRIGYE EQNEWYFFSH KDKKYPTGTR  120
TNRATMAGFW KATGRDKSVY DKTKLIGMRK TLVFYKGRAP NGQKSDWIMH EYRLESDENG  180
PPQEEGWVVC RAFKKRATGQ NKSIEGWDSS YFYEESSGVS SVVDPIDYIA RQPQNFLAQN  240
FLCNQETEGD NLSFMHSENY VQLPQLESPS LPLIKRPSSS ISLISENNNS NRVEEEQNRM  300
LSGNSAQKVT DWRALDKFVA SQLSHEDRYD GDGVSSFVGA ENNSSDMPLL LLQSGRDEGN  360
NKFNGFLSSS PDCDFGICIF EK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-504319612169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5999320.0AB599932.1 Populus trichocarpa PtVNS01 mRNA for transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011025924.10.0PREDICTED: NAC domain-containing protein 7-like isoform X2
SwissprotQ9SL411e-171NAC37_ARATH; NAC domain-containing protein 37
TrEMBLE5KUH90.0E5KUH9_POPTR; Transcription factor
STRINGPOPTR_0007s13910.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45653459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-150vascular related NAC-domain protein 1